Gene Bio Systems
Recombinant Pseudomonas aeruginosa UPF0060 membrane protein PLES_17921 (PLES_17921)
Recombinant Pseudomonas aeruginosa UPF0060 membrane protein PLES_17921 (PLES_17921)
SKU:CSB-CF488267EZY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas aeruginosa (strain LESB58)
Uniprot NO.:B7V7I2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MINYFWFVLAAFCEIAGCYAFYLWLRLGKSALWVLPGLLSLTLFALLLTRVEASYAGRAY AAYGGIYVAASLFWLAFVERSRPLWSDWLGVALCVVGASVVLFGPRLSQ
Protein Names:Recommended name: UPF0060 membrane protein PLES_17921
Gene Names:Ordered Locus Names:PLES_17921
Expression Region:1-109
Sequence Info:full length protein
