Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2(nuoA2)

Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2(nuoA2)

SKU:CSB-CF408722PZL

Regular price €1.419,95 EUR
Regular price Sale price €1.419,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain PA7)

Uniprot NO.:A6V6S8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHGILSPGAWAFIAYVLGAVALCLVMLGLGRVLGGRSHGRAKNLPFESGVDSTGSARLRF PVKYALVAMLFVIFGIEMPFLYLWAVSVRENGWAGFVEVALFVSLLLAGLFYLHRVGALD WSPERRRRKPRD

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A 2 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A 2 NDH-1 subunit A 2 NUO1 2

Gene Names:Name:nuoA2 Ordered Locus Names:PSPA7_3402

Expression Region:1-132

Sequence Info:full length protein

View full details