Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa Cytochrome c-type biogenesis protein CcmH(ccmH)

Recombinant Pseudomonas aeruginosa Cytochrome c-type biogenesis protein CcmH(ccmH)

SKU:CSB-CF872740EZX

Regular price €1.422,95 EUR
Regular price Sale price €1.422,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Uniprot NO.:Q9I3N0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AIDTYEFASDAERERFRNLTQELRCPKCQNQDIADSNAPIAADLRKQIYGQLQQGKSDGE IVDYMVARYGDFVRYKPPVNERTWLLWFGPGALLLFGVLVIGVIVLRRRRTAAKVQTTLS AEEQARLANLLKNDK

Protein Names:Recommended name: Cytochrome c-type biogenesis protein CcmH

Gene Names:Name:ccmH Ordered Locus Names:PA1482

Expression Region:21-155

Sequence Info:full length protein

View full details