Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudoalteromonas atlantica Electron transport complex protein RnfE(rnfE)

Recombinant Pseudoalteromonas atlantica Electron transport complex protein RnfE(rnfE)

SKU:CSB-CF614921PAAJ

Regular price €1.515,95 EUR
Regular price Sale price €1.515,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

Uniprot NO.:Q15RL0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNEFKQLSWQGLWKNNPALVQLLGLCPLLAVTATVTNGLGLGLATTLVLIGSNATVSIIR NLVPNEIRIPIFVMIIAAFVTVVQLLMNAYTYELYQALGIFIPLIVTNCAIIGRAEAYAS KNPIGYAAFDGLMMGLGFTVVLVLLGAMRELLGYGTLFAGANLLLGDWATSLKVTIFTTD SPFLLAILPPGAFLGMGLLIAAKNILDKRFERMFAAKQEAKVVQRARVTAET

Protein Names:Recommended name: Electron transport complex protein RnfE

Gene Names:Name:rnfE Ordered Locus Names:Patl_2970

Expression Region:1-232

Sequence Info:full length protein

View full details