Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudoalteromonas atlantica ATP synthase subunit b 2(atpF2)

Recombinant Pseudoalteromonas atlantica ATP synthase subunit b 2(atpF2)

SKU:CSB-CF621892PAAJ

Regular price €1.439,95 EUR
Regular price Sale price €1.439,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

Uniprot NO.:Q15MU0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNINATLFGELLAFIFFVWFCMKFVWPPIMGAIEERQKKIADGLAASERGEKDLELAQAK ATEQLKEAKTQAAGIIEQAKKRGSQIVDEETQRAHQERENIIAQGHAEIEAERNRAKEDL RKQVAALAVAGAERILERQIDAAAQSDIVEKLVAEL

Protein Names:Recommended name: ATP synthase subunit b 2 Alternative name(s): ATP synthase F(0) sector subunit b 2 ATPase subunit I 2 F-type ATPase subunit b 2 Short name= F-ATPase subunit b 2

Gene Names:Name:atpF2 Ordered Locus Names:Patl_4299

Expression Region:1-156

Sequence Info:full length protein

View full details