Gene Bio Systems
Recombinant Protein dct-5(dct-5)
Recombinant Protein dct-5(dct-5)
SKU:CSB-CF428911CXX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis briggsae
Uniprot NO.:A8WUE9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGIFLGLVDSSSPKSSTSCSLMTSCAVEKCLNKDMVRKIVIESSREEVFGNLVEKFDMVC IAAKCGNECSQCKHCHYALEQMSALAQGEKTSGLCPKLETCVFNCLTEDVSKVLSCVATR CNVHCYDGDCPSCKMISRRIFSTICKQHSMTSQPQIKYEGTCPNLFMELADHYVAKKKL
Protein Names:Recommended name: Protein dct-5 Alternative name(s): Daf-16/foxo controlled, germline tumor affecting protein 5
Gene Names:Name:dct-5 ORF Names:CBG02399
Expression Region:1-179
Sequence Info:full length protein
