Skip to product information
1 of 1

Gene Bio Systems

Recombinant Protein dct-5(dct-5)

Recombinant Protein dct-5(dct-5)

SKU:CSB-CF428911CXX

Regular price €1.460,95 EUR
Regular price Sale price €1.460,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis briggsae

Uniprot NO.:A8WUE9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGIFLGLVDSSSPKSSTSCSLMTSCAVEKCLNKDMVRKIVIESSREEVFGNLVEKFDMVC IAAKCGNECSQCKHCHYALEQMSALAQGEKTSGLCPKLETCVFNCLTEDVSKVLSCVATR CNVHCYDGDCPSCKMISRRIFSTICKQHSMTSQPQIKYEGTCPNLFMELADHYVAKKKL

Protein Names:Recommended name: Protein dct-5 Alternative name(s): Daf-16/foxo controlled, germline tumor affecting protein 5

Gene Names:Name:dct-5 ORF Names:CBG02399

Expression Region:1-179

Sequence Info:full length protein

View full details