Gene Bio Systems
Recombinant Prochlorococcus marinus PsbF-like protein(PMT9312_1176)
Recombinant Prochlorococcus marinus PsbF-like protein(PMT9312_1176)
SKU:CSB-CF656644PAAN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Prochlorococcus marinus (strain MIT 9312)
Uniprot NO.:Q31A60
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDFRVLLVISPIIFAWIFTVFWLGKWDVFRLTPFGLPKRGVAPFENYQVWGDSAVVPNTG RPSEGYPVFTVRTAAVNALGIPTVFFLGAILAMQFKSY
Protein Names:Recommended name: PsbF-like protein
Gene Names:Ordered Locus Names:PMT9312_1176
Expression Region:1-98
Sequence Info:full length protein
