Gene Bio Systems
Recombinant Prochlorococcus marinus Photosystem II reaction center protein J(psbJ)
Recombinant Prochlorococcus marinus Photosystem II reaction center protein J(psbJ)
SKU:CSB-CF383056PZG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Prochlorococcus marinus (strain MIT 9515)
Uniprot NO.:A2BUT1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSKLKGPDGRIPDRLPDGRPAVAWERRWTEGTLPLWLVATAGGIAVIFVLGIFFYGSYQG VGAG
Protein Names:Recommended name: Photosystem II reaction center protein J Short name= PSII-J
Gene Names:Name:psbJ Ordered Locus Names:P9515_03331
Expression Region:1-64
Sequence Info:full length protein
