
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Myxococcus xanthus
Uniprot NO.:Q93MV4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFSTFLTALRTCVVTMVLTGLLYPLAVTGLAQLLFPGEANGSWVKDGRGRVVGSALIGQG FTRAGYFHPRPSAAGAGYDGAASSGSNLGPTSLKLKERAAAELERLRRENPDAAGPVPAE LVTTSASGLDPHLSPETARWQAARVARARGVALERVLDVVDARVEGRTFGVLGEPRVNVL LLNLALDRRFGPLPDAAPGVGGRASPGQGAP
Protein Names:Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain
Gene Names:Name:kdpC
Expression Region:1-211
Sequence Info:full length protein
You may also like
-
Recombinant Potassium-transporting ATPase C chain(kdpC)
- Regular price
- €1.085,95 EUR
- Sale price
- €1.085,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Potassium-transporting ATPase C chain(kdpC)
- Regular price
- €1.108,95 EUR
- Sale price
- €1.108,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Potassium-transporting ATPase C chain(kdpC)
- Regular price
- €1.088,95 EUR
- Sale price
- €1.088,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Potassium-transporting ATPase C chain(kdpC)
- Regular price
- €1.085,95 EUR
- Sale price
- €1.085,95 EUR
- Regular price
-
- Unit price
- per
Sold out