Skip to product information
1 of 1

GeneBio Systems

Recombinant Porcellio dilatatus Androgenic gland hormone (AGH), partial

Recombinant Porcellio dilatatus Androgenic gland hormone (AGH), partial

SKU:Q86SA8

Regular price €849,95 EUR
Regular price Sale price €849,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q86SA8

Gene Names: AGH

Alternative Name(s): (Pod-AGH)

Abbreviation: Recombinant Porcellio dilatatus AGH protein, partial

Organism: Porcellio dilatatus (Woodlouse)

Source: E.coli

Expression Region: 22-65aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-KSI-tagged

Target Protein Sequence: YQVEGMKSDVICADIRFTVHCICNELGRFPTARLTKPCPWPNRE

MW: 20.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior.

Reference: "Molecular cloning and expression analysis of cDNAs encoding androgenic gland hormone precursors from two porcellionidae species, Porcellio scaber and P. dilatatus." Ohira T., Hasegawa Y., Tominaga S., Okuno A., Nagasawa H. Zool. Sci. 20: 75-81(2003)

Function:

View full details