Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo pygmaeus Beta-defensin 126(DEFB126),partial

Recombinant Pongo pygmaeus Beta-defensin 126(DEFB126),partial

SKU:CSB-YP006696EXPe0

Regular price €1.122,95 EUR
Regular price Sale price €1.122,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: A4H244

Gene Names: DEFB126

Organism: Pongo pygmaeus (Bornean orangutan)

AA Sequence: SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD

Expression Region: 21-63aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal GST-tagged

MW: 31.9 kDa

Alternative Name(s): Defensin, beta 126

Relevance: Has antibacterial activity.Curated

Reference: Evolution and sequence variation of human beta-defensin genes.Hollox E.J., Armour J.A.L.

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details