Gene Bio Systems
Recombinant Pongo abelii DnaJ homolog subfamily C member 15(DNAJC15)
Recombinant Pongo abelii DnaJ homolog subfamily C member 15(DNAJC15)
SKU:CSB-CF729057PYX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:Q5RCP4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQGLVRSLIAVGLGVAAFAFAGRYAFRI WKPLEQVITETAKKISTPSLSSYYKGGFEKKMSRREAGLILGVSPSAGKAKIRTAHRRVM ILNHPDKGGSPYVAAKINEAKDLLETTTKH
Protein Names:Recommended name: DnaJ homolog subfamily C member 15
Gene Names:Name:DNAJC15
Expression Region:1-150
Sequence Info:full length protein
