Gene Bio Systems
Recombinant Polynucleobacter sp. Protein CrcB homolog(crcB)
Recombinant Polynucleobacter sp. Protein CrcB homolog(crcB)
SKU:CSB-CF390900PYU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Polynucleobacter sp. (strain QLW-P1DMWA-1)
Uniprot NO.:A4SW33
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWLSILAIFCGAGLGALLRTGFNLLSVGVASVIPLGTLISNMVGGYLIGIALAFFGNNPH LSPEWKLLIITGFLGGLTTFSSFSAEVVTMIQRGEFTWALGTALLHLVGSLVLTLLGIWT YQAIK
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:Pnuc_0477
Expression Region:1-125
Sequence Info:full length protein
