Skip to product information
1 of 1

Gene Bio Systems

Recombinant Plasmodium falciparum Sexual stage-specific protein

Recombinant Plasmodium falciparum Sexual stage-specific protein

SKU:CSB-CF323519PMB

Regular price €1.414,95 EUR
Regular price Sale price €1.414,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Plasmodium falciparum (isolate NF54)

Uniprot NO.:P17503

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DANDKAKKPAGKGSPSTLQTPGSSSGASLHAVGPNQGGLSQGLSGKDSADKMPLETQLAI EEIKSLSNMLDKKTTVNRNLIISTAVTNMIMLIILSGIVGFKVKKTKNADDDKGDKDKDK DNTDEGDEGDDS

Protein Names:Recommended name: Sexual stage-specific protein

Gene Names:

Expression Region:26-157

Sequence Info:full length protein

View full details