Gene Bio Systems
Recombinant Pig Potassium voltage-gated channel subfamily KQT member 1(KCNQ1)
Recombinant Pig Potassium voltage-gated channel subfamily KQT member 1(KCNQ1)
SKU:CSB-CF871323PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:Q9TTJ7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:IIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHR QELITTLYIGFLGLIFSSYFVYLAEKDAVNESGQVEFGSYADALWWGVVTVTTIGYGDKV PQT
Protein Names:Recommended name: Potassium voltage-gated channel subfamily KQT member 1 Alternative name(s): IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1 KQT-like 1 Voltage-gated potassium channel subunit Kv7.1
Gene Names:Name:KCNQ1 Synonyms:KVLQT1
Expression Region:1-123
Sequence Info:full length protein
