Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Potassium voltage-gated channel subfamily KQT member 1(KCNQ1)

Recombinant Pig Potassium voltage-gated channel subfamily KQT member 1(KCNQ1)

SKU:CSB-CF871323PI

Regular price €1.397,95 EUR
Regular price Sale price €1.397,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:Q9TTJ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHR QELITTLYIGFLGLIFSSYFVYLAEKDAVNESGQVEFGSYADALWWGVVTVTTIGYGDKV PQT

Protein Names:Recommended name: Potassium voltage-gated channel subfamily KQT member 1 Alternative name(s): IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1 KQT-like 1 Voltage-gated potassium channel subunit Kv7.1

Gene Names:Name:KCNQ1 Synonyms:KVLQT1

Expression Region:1-123

Sequence Info:full length protein

View full details