Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Pig Calcium-activated chloride channel regulator 1(CLCA1),partial

CSB-EP886948PI
Regular price
€752,95 EUR
Sale price
€752,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q9TUB5

Gene Names: CLCA1

Organism: Sus scrofa (Pig)

AA Sequence: DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ

Expression Region: 46-199aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 22.8 kDa

Alternative Name(s): Calcium-activated chloride channel family member 1 pCLCA1 AECC

Relevance: May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells.

Reference: "pCLCA1 lacks inherent chloride channel activity in an epithelial colon carcinoma cell line." Loewen M.E., Bekar L.K., Walz W., Forsyth G.W., Gabriel S.E. Am. J. Physiol. 287:G33-G41(2004)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • CLCA1 Antibody - Cat. #: CSB-PA005474LA01HU
    Regular price
    €304,95 EUR
    Sale price
    €304,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • CLCA1 Antibody, FITC conjugated - Cat. #: CSB-PA005474LC01HU
    Regular price
    €304,95 EUR
    Sale price
    €304,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • CLCA1 Antibody, Biotin conjugated - Cat. #: CSB-PA005474LD01HU
    Regular price
    €304,95 EUR
    Sale price
    €304,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • CLCA1 Antibody, HRP conjugated - Cat. #: CSB-PA005474LB01HU
    Regular price
    €304,95 EUR
    Sale price
    €304,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share