Gene Bio Systems
Recombinant Picea abies Cytochrome b6-f complex subunit 4(petD)
Recombinant Picea abies Cytochrome b6-f complex subunit 4(petD)
SKU:CSB-CF529842EVK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Picea abies (Norway spruce) (Picea excelsa)
Uniprot NO.:O47044
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGATKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLSYIFPVVILGTIACTIGLAVLEPS MIGEPANPFATPLEILPEWYLFPVFQILRTVPNKLLGVLLMASVPAGSLTVPFLENVNQF QNPFRRPVATTVSLIGTAVALWLGIGAALPIDESLTLGLFQFDPTVEYKNLSIFYSYI
Protein Names:Recommended name: Cytochrome b6-f complex subunit 4 Alternative name(s): 17 kDa polypeptide
Gene Names:Name:petD
Expression Region:1-178
Sequence Info:full length protein
