Gene Bio Systems
Recombinant Photorhabdus luminescens subsp. laumondii Spermidine export protein MdtJ(mdtJ)
Recombinant Photorhabdus luminescens subsp. laumondii Spermidine export protein MdtJ(mdtJ)
SKU:CSB-CF755717PIJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Photorhabdus luminescens subsp. laumondii (strain TT01)
Uniprot NO.:Q7N537
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIYWLFLAMAIITEVIGTLSMKHASVSGGVVGMAVMYIMIATSYILLAMAVKKVALGVAY ALWEGVGILFITVFSVMWFDESLSLMKVGGLALLITGIMLIKSGTRKAAVKKSAEVVKQM ANKAVSVATTKSSKIKEA
Protein Names:Recommended name: Spermidine export protein MdtJ
Gene Names:Name:mdtJ Ordered Locus Names:plu2123
Expression Region:1-138
Sequence Info:full length protein
