Gene Bio Systems
Recombinant Pelobacter propionicus ATP synthase subunit a 3(atpB3)
Recombinant Pelobacter propionicus ATP synthase subunit a 3(atpB3)
SKU:CSB-CF372744PYF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Pelobacter propionicus (strain DSM 2379)
Uniprot NO.:A1AP45
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVHPFLFLEFLRKMLAPLHLSEASADAVSYTWLIIALLLLLSFLATRALKTVPGGLQNFM EIIVGGIENMVTETMGEHGRPYFPLVATIGIFVLVSNLIGLIPGFFPPTANINTTAACAI VVFLSTHVVGIKRHGIGYIKHFCGPILWLTPIMFFIEVIGHLSRPVSLTLRLFGNMNGHE LVLIIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLTMIYIQGSLEEAH
Protein Names:Recommended name: ATP synthase subunit a 3 Alternative name(s): ATP synthase F0 sector subunit a 3 F-ATPase subunit 6 3
Gene Names:Name:atpB3 Ordered Locus Names:Ppro_1500
Expression Region:1-229
Sequence Info:full length protein
