Gene Bio Systems
Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF84(ORF84)
Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF84(ORF84)
SKU:CSB-CF761406OBAD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ostreid herpesvirus 1 (isolate France) (OsHV-1) (Pacific oyster herpesvirus)
Uniprot NO.:Q6R7E5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVQGYIHGLDSYNINEASLLIRSDLVKVVEAITGNNDASYIFLLIIITIIFALTMYTSVQ VLIRTMRTTISKSVMDDNLKKKYGFERMRNKKRKKRSNATDTAILMNTMLDDDSTDEF
Protein Names:Recommended name: Uncharacterized protein ORF84
Gene Names:ORF Names:ORF84
Expression Region:1-118
Sequence Info:full length protein
