Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Peroxisomal membrane protein 11-5(PEX11-5)

Recombinant Oryza sativa subsp. japonica Peroxisomal membrane protein 11-5(PEX11-5)

SKU:CSB-CF722784OFG

Regular price €1.522,95 EUR
Regular price Sale price €1.522,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q5VRJ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSLESARADLALLILYLNKAEARDKICRAIQYGSKFVSNGQPGPAQNVDKSTSLARKVF RLFKFVNDLHALISPPAKGTPLPLILLGKSKNALLSTFLFLDQIVWAGRTGIYKNKERAE FLSKIAFYCFLGSNTCTSIIEVAELQRLSKSMKKLEKELKHQELLKNEQYQMKLQKCNER RLALIKSSLDIVVAIGLLQLAPKKVTPRVTGAFGFASSLIACYQLLPAPAKSK

Protein Names:Recommended name: Peroxisomal membrane protein 11-5 Alternative name(s): OsPEX11-2 OsPEX11-5 Peroxin-11-5

Gene Names:Name:PEX11-5 Ordered Locus Names:Os06g0127000, LOC_Os06g03660 ORF Names:OSJNBa0038F22.10-1, P0425F02.44-1

Expression Region:1-233

Sequence Info:full length protein

View full details