Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Cytochrome c oxidase subunit 5C(COX5C)

Recombinant Oryza sativa subsp. japonica Cytochrome c oxidase subunit 5C(COX5C)

SKU:CSB-CF879877OFG

Regular price €1.348,95 EUR
Regular price Sale price €1.348,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q9SXX7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AGGRIAHATLKGPSVVKEICIGLTLGLVAGGLWKMHHWNEQRKTRSFYDMLEKGQISVVV EE

Protein Names:Recommended name: Cytochrome c oxidase subunit 5C Alternative name(s): Cytochrome c oxidase polypeptide Vc

Gene Names:Name:COX5C Ordered Locus Names:Os12g0561000, LOC_Os12g37419

Expression Region:2-63

Sequence Info:full length protein

View full details