Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Cytochrome b5 (Os05g0108800, LOC_Os05g01820)
Recombinant Oryza sativa subsp. japonica Cytochrome b5 (Os05g0108800, LOC_Os05g01820)
SKU:CSB-CF006309OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:P49100
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDF EDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQDKTPEFIIKILQFLVPLA ILGLAVAIRIYTKSESA
Protein Names:Recommended name: Cytochrome b5
Gene Names:Ordered Locus Names:Os05g0108800, LOC_Os05g01820 ORF Names:OSJNBa0068N01.16
Expression Region:1-137
Sequence Info:full length protein
