Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Copper transporter 6(COPT6)

Recombinant Oryza sativa subsp. japonica Copper transporter 6(COPT6)

SKU:CSB-CF767130OFG

Regular price €1.467,95 EUR
Regular price Sale price €1.467,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q7XTF8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRGMGDDGMGPMAMAPPRSGHATAAAPPPPQHKMAMMMHMTFFWSDRAVVLIRGWPGERG AGMYALCLLFVLALAALTEGLSVLSRRLARRGGGAASSDGGRPAPAPASSAALLTAVHAA RMGMAYLVMLAVMSFNVGVLLAAVAGHALGFLLARSRVRPAARDGGGGVACEHGGLPPAD GSKT

Protein Names:Recommended name: Copper transporter 6 Short name= OsCOPT6

Gene Names:Name:COPT6 Ordered Locus Names:Os04g0415600, LOC_Os04g33900 ORF Names:OJ991214_12.9

Expression Region:1-184

Sequence Info:full length protein

View full details