Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Copper transporter 5.1(COPT5.1)
Recombinant Oryza sativa subsp. japonica Copper transporter 5.1(COPT5.1)
SKU:CSB-CF724353OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q69P80
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMHMTFYWGKDVTILFDGWRTATWTGYLLSLVALLLASAFYQYLEAFRIRVKLLAGAKPA SIPPPASSDAARAPLLLPSSAAGRWPARLATAGLFGVNSGLGYLLMLAVMSFNGGVFVAV VVGLAAGYLAFRSSDGEDLVVVDNPCACA
Protein Names:Recommended name: Copper transporter 5.1 Short name= OsCOPT5.1
Gene Names:Name:COPT5.1 Ordered Locus Names:Os09g0440700, LOC_Os09g26900 ORF Names:OJ1344_B01.31
Expression Region:1-149
Sequence Info:full length protein
