Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Copper transporter 3(COPT3)
Recombinant Oryza sativa subsp. japonica Copper transporter 3(COPT3)
SKU:CSB-CF726473OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q5ZD08
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADMGRHGMAMAMAPAAAGGAGRRKRYMHMTFYWGKNSEILFTGWPGASGGMYALALAAV FALAVLLEFLGSPRVQESSSLGSRRRRATAAAVHAVRVGLAYLLMLALMSFNVGVLLAAV AGHAAGFLAFRAGLCGGGYKKGELAPAACC
Protein Names:Recommended name: Copper transporter 3 Short name= OsCOPT3
Gene Names:Name:COPT3 Ordered Locus Names:Os01g0770800, LOC_Os01g56430 ORF Names:P0665A11.23
Expression Region:1-150
Sequence Info:full length protein
