Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein 2, chloroplastic(CAB2R)
Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein 2, chloroplastic(CAB2R)
SKU:CSB-CF320959OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:P12331
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RKSAAKPKPAASGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIH AQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein 2, chloroplastic Alternative name(s): LHCII type I CAB-2 Short name= LHCP
Gene Names:Name:CAB2R Ordered Locus Names:Os01g0600900, LOC_Os01g41710 ORF Names:P0518F01.17-1
Expression Region:30-261
Sequence Info:full length protein
