Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein 1, chloroplastic(CAB1R)

Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein 1, chloroplastic(CAB1R)

SKU:CSB-CF319390OFG

Regular price €1.516,95 EUR
Regular price Sale price €1.516,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:P12330

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTAAKPKPAASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFA KNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLI HAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVK EIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 1, chloroplastic Alternative name(s): LHCII type I CAB-1 Short name= LHCP

Gene Names:Name:CAB1R Ordered Locus Names:Os09g0346500, LOC_Os09g17740 ORF Names:OSJNBb0085I16.35, P0512H04.4

Expression Region:33-265

Sequence Info:full length protein

View full details