Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Casparian strip membrane protein Os04g0460400(Os04g0460400, LOC_Os04g38690)

Recombinant Oryza sativa subsp. japonica Casparian strip membrane protein Os04g0460400(Os04g0460400, LOC_Os04g38690)

SKU:CSB-CF800042OFG

Regular price €1.473,95 EUR
Regular price Sale price €1.473,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q7XUV7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEHGEISSKAPLVAPVAAGVNRAVAVVDTFLRFIAIIGTIGSAIAMGTTNETLPFFTQFI QFEAKYSDLPSFTFFVAANAVVCTYLVLSIPLSIVHILRPRARYSRLFLVFFDTAMLALL TAGASAAAAIVYLAHKGNVRANWFSICQQFDSFCERISGSLIGSFAAMVLLVVLITLSAF ALARRH

Protein Names:Recommended name: Casparian strip membrane protein Os04g0460400

Gene Names:Ordered Locus Names:Os04g0460400, LOC_Os04g38690 ORF Names:OsJ_014458, OSJNBa0072F16.8

Expression Region:1-186

Sequence Info:full length protein

View full details