Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET5(SWEET5)

Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET5(SWEET5)

SKU:CSB-CF760905OFG

Regular price €1.526,95 EUR
Regular price Sale price €1.526,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q6L568

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVMNPDAVRNVVGIIGNLISFGLFLSPLPTFVTIVKKKDVEEFVPDPYLATFLNCALWVF YGLPFIHPNSILVVTINGTGLLIEIAYLAIYFAYAPKPKRCRMLGVLTVELVFLAAVAAG VLLGAHTYDKRSLIVGTLCVFFGTLMYAAPLTIMKQVIATKSVEYMPFTLSLVSFINGIC WTIYAFIRFDILITIPNGMGTLLGAAQLILYFCYYDGSTAKNKGALELPKDGDSSAV

Protein Names:Recommended name: Bidirectional sugar transporter SWEET5 Short name= OsSWEET5

Gene Names:Name:SWEET5 Ordered Locus Names:Os05g0588500, LOC_Os05g51090 ORF Names:OJ1007_H05.17, OJ1115_D04.3, OsJ_19730

Expression Region:1-237

Sequence Info:full length protein

View full details