Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 4(APRL4)

Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 4(APRL4)

SKU:CSB-CF691532OFG

Regular price €1.523,95 EUR
Regular price Sale price €1.523,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q5DJV7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GHGVCPRQPAAAAVLPRQSSCPAAGSPGHRAHHVGVVEGDDFVLQKAVTLVLQNREDFVA ILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEESRIKPRMLSRYGVRAFPTLFLVNST MRVRYHGSRTMNSLAMFYKDVTGMNPVSLDAISLERMEEVVNIIENDKKTEQGDSLFMFA RSPDRLLHQDTCLALASSFVLMRLLCFLLPKLNACVKQAWRMQFYELKRLLSNLS

Protein Names:Recommended name: 5'-adenylylsulfate reductase-like 4 Alternative name(s): Adenosine 5'-phosphosulfate reductase-like 4 Short name= APR-like 4 Short name= OsAPRL4

Gene Names:Name:APRL4 Ordered Locus Names:Os08g0412401, LOC_Os08g31814 ORF Names:OSJNBa0007M04.15

Expression Region:30-264

Sequence Info:full length protein

View full details