Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa Chloroplast envelope membrane protein(cemA)

Recombinant Oryza sativa Chloroplast envelope membrane protein(cemA)

SKU:CSB-CF313547OCO

Regular price €1.514,95 EUR
Regular price Sale price €1.514,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa (Rice)

Uniprot NO.:P0C302

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKKKALPSFLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSQTLLTAIQEKRVLERF MELEDLFILDEMIKEKPNTHVQNPPIGIRKEIIQLAKIDNEGHLHIILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSVKAFFILLVTDFFVGFHSTRGWELLIRWVYND LGWVPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA

Protein Names:Recommended name: Chloroplast envelope membrane protein

Gene Names:Name:cemA Synonyms:ycf10

Expression Region:1-230

Sequence Info:full length protein

View full details