
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oliveros virus (isolate Mouse/Argentina/RIID 3229/1990) (OLVV)
Uniprot NO.:Q84168
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AFLTWTLSDATGNDLPGGYCLEQWAIVWAGIKCFGNTAVAKCNQNHDSEFCDMLRLFDYN RNAIKSLNDQSQSRLNLLTNTINSLISDNLLMKNKLAEIMNIPYCNYTKFWYINDTRTGR HTLPQCWLISNGSYLNETKFRTQWLSESNALYTEMLTEDYDKRQGSTPLSLVDLCFWSTL FYVTTLFAHLVGFPTHRHILDGPCPKPHRLTKKGICSCGHFGIPGKPVRWVKRSR
Protein Names:Recommended name: Pre-glycoprotein polyprotein GP complex Cleaved into the following 3 chains: 1. Stable signal peptide Short name= 2. SSP 3. Glycoprotein G1 Short name= 4. GP1 5. Glycoprotein G2 Short name= 6. GP2
Gene Names:Name:GPC Synonyms:GP-C
Expression Region:284-518
Sequence Info:full length protein
You may also like
-
Recombinant Latino virus Pre-glycoprotein polyprotein GP complex(GPC)
- Regular price
- €1.365,95 EUR
- Sale price
- €1.365,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Chapare virus Pre-glycoprotein polyprotein GP complex(GPC)
- Regular price
- €1.364,95 EUR
- Sale price
- €1.364,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Ippy virus Pre-glycoprotein polyprotein GP complex(GPC)
- Regular price
- €1.363,95 EUR
- Sale price
- €1.363,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pirital virus Pre-glycoprotein polyprotein GP complex(GPC)
- Regular price
- €1.365,95 EUR
- Sale price
- €1.365,95 EUR
- Regular price
-
- Unit price
- per
Sold out