Skip to product information
1 of 1

GeneBio Systems

Recombinant Oenococcus oeni Malolactic enzyme (mleA), partial

Recombinant Oenococcus oeni Malolactic enzyme (mleA), partial

SKU:Q48796

Regular price €844,95 EUR
Regular price Sale price €844,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q48796

Gene Names: mleA

Alternative Name(s): (MLE)

Abbreviation: Recombinant Oenococcus oeni mleA protein, partial

Organism: Oenococcus oeni (Leuconostoc oenos)

Source: E.coli

Expression Region: 260-516aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: IQGTGIVVLAGVLGALKISGQKLTDQTYMSFGAGTAGMGIVKQLHEEMVEQGLSDEEAKKHFFLVDKQGLLFDDDPDLTPEQKPFAAKRSDFKNANQLTNLQAAVEAVHPTILVGTSTHPNSFTEEIVKDMSGYTERPIIFPISNPTKLAEAKAEDVLKWSNGKALIGTGVPVDDIEYEGNAYQIGQANNALIYPGLGFGAIAAQSKLLTPEMISAAAHSLGGIVDTTKVGAAVLPPVSKLADFSRTVAVAVAKKAV

MW: 31.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Involved in the malolactic fermentation (MLF) of wine, which results in a natural decrease in acidity and favorable changes in wine flavors. Catalyzes the decarboxylation of L-malate to L-lactate. It can also use pyruvate as substrate.

Reference: "Malolactic enzyme from Oenococcus oeni: heterologous expression in Escherichia coli and biochemical characterization." Schuemann C., Michlmayr H., Del Hierro A.M., Kulbe K.D., Jiranek V., Eder R., Nguyen T.H. Bioengineered 4: 147-152(2013)

Function:

View full details