Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oceanobacillus iheyensis Lipoprotein signal peptidase(lspA)

Recombinant Oceanobacillus iheyensis Lipoprotein signal peptidase(lspA)

SKU:CSB-CF809845OAB

Regular price €1.440,95 EUR
Regular price Sale price €1.440,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Uniprot NO.:Q8ER40

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIMYYLIAIALVIIDQLTKWLVVSRMELGESISVIDNFFYITSHRNTGAAWGILEGQMLL FYIITTIVIIGIIYFLHTHAKGDKLLSVALVVILGGAIGNFIDRIFRQEVVDFANFYIFD YNFPIFNVADSSLTIGVILFLIATILEEKRQKGKSKS

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA Ordered Locus Names:OB1485

Expression Region:1-157

Sequence Info:full length protein

View full details