Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nuclear envelope phosphatase-regulatory subunit 1 homolog(T19A6.3)

Recombinant Nuclear envelope phosphatase-regulatory subunit 1 homolog(T19A6.3)

SKU:CSB-CF895958CXY

Regular price €1.423,95 EUR
Regular price Sale price €1.423,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q9XXN3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAIQARRMPEDPSTACEDLKFFEKRLTEVITYMGPTCTRWRIAIVIFAVLVGVIGSKYFA NEKIEIFQIPMIDMFLTTHLDFTLCFFVGLLLFAVFGVHRRIVAPTIVARRCRDALSPFS LSCDHNGKLIVKPAVRNSAP

Protein Names:Recommended name: Nuclear envelope phosphatase-regulatory subunit 1 homolog Short name= NEP1-R1 Alternative name(s): Transmembrane protein 188

Gene Names:ORF Names:T19A6.3

Expression Region:1-140

Sequence Info:full length protein

View full details