Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nostoc sp. Potassium-transporting ATPase C chain 1(kdpC1)

Recombinant Nostoc sp. Potassium-transporting ATPase C chain 1(kdpC1)

SKU:CSB-CF835135NHR

Regular price €1.484,95 EUR
Regular price Sale price €1.484,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nostoc sp. (strain PCC 7120 / UTEX 2576)

Uniprot NO.:Q8YSD7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFAREASRAIRSSFVLWVIAAVIYPFFMIAVGQIVFPHQANGSLVRDSRGQVLGSTLIG QPFTSDRYFNSRPSTTVYSTANPNKDDNLVLQTGISGASNLAPSNPQLIERIKDEDLNRL QTSGIQPTADLVYTSGSSLDPHITPEAARAQVSRIAKVRQLPPQQLETLITQNTDSRFLG IFGEPGVNVLQLNLALDELKPT

Protein Names:Recommended name: Potassium-transporting ATPase C chain 1 EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain 1 Potassium-binding and translocating subunit C 1 Potassium-translocating ATPase C cha

Gene Names:Name:kdpC1 Ordered Locus Names:all3151

Expression Region:1-202

Sequence Info:full length protein

View full details