Gene Bio Systems
Recombinant Nocardia farcinica Probable cytochrome c oxidase polypeptide 4(ctaF)
Recombinant Nocardia farcinica Probable cytochrome c oxidase polypeptide 4(ctaF)
SKU:CSB-CF733487NAAA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nocardia farcinica (strain IFM 10152)
Uniprot NO.:Q5YZ36
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRIEARIFELLTVFFIIVGVVYGFFTAQSRTGVEWAGTTAIVLTAGLSLIIGTYFRFVAR RLDLRPEDYEDAEIVDGAGDLGFFSPGSFWPILLAGAGSVAALGLAFFEPWLIAVGVICV IAAAAGLVFEYHLGPEKH
Protein Names:Recommended name: Probable cytochrome c oxidase polypeptide 4 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 4 Cytochrome c oxidase polypeptide IV
Gene Names:Name:ctaF Ordered Locus Names:NFA_17090
Expression Region:1-138
Sequence Info:full length protein
