Gene Bio Systems
Recombinant Nitrobacter winogradskyi ATP synthase subunit b-b'(atpG)
Recombinant Nitrobacter winogradskyi ATP synthase subunit b-b'(atpG)
SKU:CSB-CF667470NAAK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391)
Uniprot NO.:Q3SW37
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAESHGNAHGATAHTEADGGHKAPFPPFQKETFASQLVSLTIAFVALYLISSRLALPRVR QTIDDRENTIKGDLAQAQKLKDDSDAALKAYEAELAAARARAQAIGNETREKLNAAAEAE RKALEERLSVKLADAEKTIASTRAAAMSNVRGIASDAATAIVQQLTGATPDSKLVDSAVD ASMKG
Protein Names:Recommended name: ATP synthase subunit b/b' Alternative name(s): ATP synthase F(0) sector subunit b/b' ATPase subunit II F-type ATPase subunit b/b' Short name= F-ATPase subunit b/b'
Gene Names:Name:atpG Ordered Locus Names:Nwi_0236
Expression Region:1-185
Sequence Info:full length protein
