Recombinant Neurospora crassa V-type proton ATPase 16 kDa proteolipid subunit(vma-3)

SKU: CSB-CF002389NHA

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:P31413

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDLCPVYAPFFGAMGCTAAIVFTCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMA GIIGIYGLVVSVLISDALTQDHYALYTGFIQLGAGLAVGLAGLAAGFAIGIVGDAGVRGT AQQPRLFVGMILILIFAEVLGLYGLIVALLMNSKATLNTSC

Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit

Gene Names:Name:vma-3 ORF Names:12F11.130, NCU01332

Expression Region:1-161

Sequence Info:full length protein