Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neospora caninum Dense granule protein 2(DG2)

Recombinant Neospora caninum Dense granule protein 2(DG2)

SKU:CSB-CF638845NBZ

Regular price €1.476,95 EUR
Regular price Sale price €1.476,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neospora caninum (Coccidian parasite)

Uniprot NO.:Q25540

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANNRTLARRRRAFSPLTVVMLAVTLVAFMGVPLSSTGAADAADPVESVEANRRGYTSYG EPPVAVGTSEEYVNSSELAGSRDKGNAEAEEEAAEVETDVQPSSVTIDTEERAAPSQVQV QQERMEEADDAPKPVPVRSAVPSTVAKRQQARHRVIGTAVIAAVVAALLWKFSRRRSGAP REGGENENGGEEK

Protein Names:Recommended name: Dense granule protein 2 Alternative name(s): Antigen Nc14.1 NcDG2

Gene Names:Name:DG2

Expression Region:1-193

Sequence Info:full length protein

View full details