Gene Bio Systems
Recombinant Neosartorya fumigata Vacuolar ATPase assembly integral membrane protein VMA21(vma21)
Recombinant Neosartorya fumigata Vacuolar ATPase assembly integral membrane protein VMA21(vma21)
SKU:CSB-CF025866NGT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Uniprot NO.:B0XYF0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSRRSQEKSYAEAAAAPPPKESASSDVTPAVPADVIYKLLGFTAAMVVGPIGMYFVTVN SGGMSFFHQTSNFSLFETLTRIASPTVAGITAAITANLVLFGYIYVAWLDDREEREAASK RNEKKAQ
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:Name:vma21 ORF Names:AFUB_040680
Expression Region:1-127
Sequence Info:full length protein
