Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neosartorya fumigata Mitochondrial import inner membrane translocase subunit tim21(tim21)

Recombinant Neosartorya fumigata Mitochondrial import inner membrane translocase subunit tim21(tim21)

SKU:CSB-CF709387NGS

Regular price €1.490,95 EUR
Regular price Sale price €1.490,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Uniprot NO.:Q4X1I8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATQSDLGGGSGSKATPRRRNVTVLSDDGRYEWGELSGREKVARATQQSLNFLVIVAGAVL TGGVFYLLYTEVFSPNSRTWQFEKAVQRIKDDPRCTDLLGDRREIKAYGESTGSRWERNR PIATSMFKDRQGREHMKMHFHVEGPLNSGIVIVHMMKPLDKDEWEYLLLALDVKGHSRVI LEQAQEKPGVAKALKIFGIQWR

Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit tim21

Gene Names:Name:tim21 ORF Names:AFUA_2G09820

Expression Region:36-237

Sequence Info:full length protein

View full details