Recombinant Neosartorya fischeri Vacuolar ATPase assembly integral membrane protein VMA21(vma21)

SKU: CSB-CF025866NEZ

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) (Aspergillus fischerianus)

Uniprot NO.:A1D7K7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSRRSQEKSYAEAAAAPPPKEAASSDVTPAVPADVIYKLLGFTAAMVVGPIGMYFITVN SGASSTVAGITAAITANLVLFGYIYVAWLDDREEREAASKKKEKKAQ

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21

Gene Names:Name:vma21 ORF Names:NFIA_068710

Expression Region:1-107

Sequence Info:full length protein