Gene Bio Systems
Recombinant Natronomonas pharaonis Uncharacterized protein NP1057A(NP1057A)
Recombinant Natronomonas pharaonis Uncharacterized protein NP1057A(NP1057A)
SKU:CSB-CF659160NAAJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Natronomonas pharaonis (strain DSM 2160 / ATCC 35678)
Uniprot NO.:Q3IUT9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVEIQTGLRENTVGAVEQFAEIASIDPLVASMILSGAIIITVAVVAFGALTLGAIGASIK RGLSGSEEPNQPA
Protein Names:Recommended name: Uncharacterized protein NP1057A
Gene Names:Ordered Locus Names:NP1057A ORF Names:NP1057E
Expression Region:1-73
Sequence Info:full length protein
