Gene Bio Systems
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG131 homolog(MPN_270)
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG131 homolog(MPN_270)
SKU:CSB-CF884174MLW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Uniprot NO.:Q9EXD1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQYTVLIPLFIFIGAMVLFGFSFQKKQPQRRIVQILFLAYCVDFLALIIAVMMLTFLSYD DLMLGVLIPVLILSIIMFFVMIIAHYPLMKRLFGH
Protein Names:Recommended name: Uncharacterized protein MG131 homolog
Gene Names:Ordered Locus Names:MPN_270 ORF Names:MP563.1
Expression Region:1-95
Sequence Info:full length protein
