Gene Bio Systems
Recombinant Mycoplasma pneumoniae Oligoendopeptidase F homolog(pepF),partial
Recombinant Mycoplasma pneumoniae Oligoendopeptidase F homolog(pepF),partial
SKU:CSB-EP346917MLW
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Microbiology
Uniprot ID: P54125
Gene Names: pepF
Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
AA Sequence: MNNQYNWNLEVLLNGKSLADNFTELKQLSEQEKALYDGGACFQTKAKFTEFLQLQEKIEVLENRYSNFLSNKHAENSLDKTINDALFQYEMFKSEHALVFVDFEKNLFKHEKVIRAYLQDPALKQYQRDFELVWRNKKHQIDPASQKLLAQISPAWNQADKIFNVLSTADLNLQPVVYKGKTYVINAVSDYQSLLENKDRGLREAAYKVW
Expression Region: 1-210aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 40.6 kDa
Alternative Name(s):
Relevance:
Reference: "Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996) .
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
