Skip to product information
1 of 1

Gene Bio Systems

Recombinant Murid herpesvirus 1 Glycoprotein N(GN)

Recombinant Murid herpesvirus 1 Glycoprotein N(GN)

SKU:CSB-CF724335MJT

Regular price €1.421,95 EUR
Regular price Sale price €1.421,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Murid herpesvirus 1 (strain Smith) (MuHV-1) (Mouse cytomegalovirus)

Uniprot NO.:Q69150

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MACGKTESGDDSGRFGRTGAGMFGFIMPGFVGIFRLSFFLLLSFAMASGSSSPASVPVSV AASVPDTTVNKIVISDGSEAHNINEFYDVKCHSHFYGLSVSSFASIWMMVNAIVFICAFG VFMRHWCYKAFTSDTAKGY

Protein Names:Recommended name: Glycoprotein N Short name= gN Alternative name(s): Structural glycoprotein UL73 Short name= gpUL73

Gene Names:Name:GN ORF Names:UL73

Expression Region:1-139

Sequence Info:full length protein

View full details