Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse VIP36-like protein(Lman2l)

Recombinant Mouse VIP36-like protein(Lman2l)

SKU:CSB-CF012994MO

Regular price €1.586,95 EUR
Regular price Sale price €1.586,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P59481

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GQAVEYLKREHSLSKPYQGVGTSSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLKDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQHERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNIRYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEMPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTGVRTPEEEKLHRDVFLPSVDNLKLPEMTVPPTPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQDQSRKRFY

Protein Names:Recommended name: VIP36-like protein Alternative name(s): Lectin mannose-binding 2-like Short name= LMAN2-like protein

Gene Names:Name:Lman2l Synonyms:Vipl

Expression Region:44-347

Sequence Info:full length protein

View full details