Recombinant Mouse V-type proton ATPase subunit e 2(Atp6v0e2)

SKU: CSB-CF852796MO

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q91XE7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE

Protein Names:Recommended name: V-type proton ATPase subunit e 2 Short name= V-ATPase subunit e 2 Alternative name(s): Vacuolar proton pump subunit e 2

Gene Names:Name:Atp6v0e2

Expression Region:1-81

Sequence Info:full length protein